Rabbit Polyclonal Antibody against SWAP70 (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SWAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-256 amino acids from the Central region of human SWAP70. |
Mouse Monoclonal SWAP70 Antibody
| Applications | IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against SWAP70
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EEREKNWKEKKTTE, from the C Terminus of the protein sequence according to NP_055870.2. |
Rabbit Polyclonal Anti-SWAP70 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SWAP70 antibody: synthetic peptide directed towards the N terminal of human SWAP70. Synthetic peptide located within the following region: ALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVK |
SWAP70 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SWAP70 |
SWAP70 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SWAP70 |
SWAP70 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 316-585 of human SWAP70 (NP_055870.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
