Antibodies

Jump to Filters
View as table Download
Syncollin (SYCN) Rabbit Polyclonal Antibody
TA336984

USD 350.00

5 Days

Rabbit Polyclonal Syncollin Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A portion of amino acids 50-100 of human syncollin was used as the immunogen.
Syncollin (SYCN) Rabbit Polyclonal Antibody
TA338321

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYCN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SYCN antibody is: synthetic peptide directed towards the N-terminal region of Human SYCN. Synthetic peptide located within the following region: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYE