Syncollin (SYCN) Rabbit Polyclonal Antibody

CAT#: TA338321

Rabbit Polyclonal Anti-SYCN Antibody

Product Images

WB Suggested Anti-SYCN Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYCN antibody is: synthetic peptide directed towards the N-terminal region of Human SYCN. Synthetic peptide located within the following region: MSPLRPLLLALALASVPCAQGACPASADLKHSDGTRTCAKLYDKSDPYYE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: syncollin
• Database Link:
  NP_001073937
  Entrez Gene 342898 Human
  UniProt ID Q0VAF6
• Background: SYCN functions in exocytosis in pancreatic acinar cells regulating the fusion of zymogen granules with each other. SYCN may have a pore-forming activity on membranes and regulate exocytosis in other exocrine tissues.
• Synonyms: INSSA1; SYL
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Dog: 86%; Pig: 86%; Rat: 79%; Mouse: 79%