Antibodies

Jump to Filters
View as table Download
SYT10 Rabbit Polyclonal Antibody
TA316356

USD 345.00

4 Weeks

Rabbit polyclonal anti-SYT10 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SYT10.
SYT10 Rabbit Polyclonal Antibody
TA331512

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYT10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SYT10 Antibody is: synthetic peptide directed towards the middle region of Human SYT10. Synthetic peptide located within the following region: RGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELL