SYT10 Rabbit Polyclonal Antibody

CAT#: TA331512

Rabbit Polyclonal Anti-SYT10 Antibody

Product Images

Host: Rabbit; Target Name: SYT10; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYT10 Antibody is: synthetic peptide directed towards the middle region of Human SYT10. Synthetic peptide located within the following region: RGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQYDYENELL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: synaptotagmin 10
• Database Link:
  NP_945343
  Entrez Gene 341359 Human
  UniProt ID Q6XYQ8
• Background: SYT10 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
• Synonyms: MGC119436; MGC119437
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%; Bovine: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane