Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SYT17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SYT17 antibody is: synthetic peptide directed towards the middle region of Human SYT17. Synthetic peptide located within the following region: CLLPDQKNSKQTGVKRKTQKPVFEERYTFEIPFLEAQRRTLLLTVVDFDK |
Rabbit Polyclonal Anti-Syt17 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Syt17 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Syt17. Synthetic peptide located within the following region: AQTPPWLMASRSNDKDGDSVHTASDVPLTPRTNSPDGRRSSSDTSKSTYS |
SYT17 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SYT17 |
SYT17 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-474 of human SYT17 (NP_057608.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SYT17