Rabbit Polyclonal Anti-SYT9 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYT9 antibody: synthetic peptide directed towards the middle region of human SYT9. Synthetic peptide located within the following region: PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL |
Goat Anti-SYT9 / Synaptotagmin-9 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EHDSCQDFIYHLRD, from the N Terminus of the protein sequence according to NP_783860.1. |
Anti-SYT9 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 90-200 amino acids of human synaptotagmin IX |
SYT9 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human SYT9 |
SYT9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-250 of human SYT9 (NP_783860.1). |
Germany
Japan
United Kingdom
China
