SYT9 Rabbit Polyclonal Antibody

CAT#: TA337555

Rabbit Polyclonal Anti-SYT9 Antibody

Product Images

WB Suggested Anti-SYT9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Muscle

• 

  Sample Type: complete mouse retina sections; Red: Primary; Blue: DAPI; Primary Dilution: 1: 200; Secondary Antibody: Goat anti-Rabbit AF568 IgG (H+L); Secondary Dilution: 1: 200; Image Submitted by: David Zenisek; Yale University

• 

  Sample Type: outer mouse plexiform layer; Red: Primary; Blue: DAPI; Primary Dilution: 1: 200; Secondary Antibody: Goat anti-Rabbit AF568 IgG (H+L); Secondary Dilution: 1: 200; Image Submitted by: David Zenisek; Yale University

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SYT9 antibody: synthetic peptide directed towards the middle region of human SYT9. Synthetic peptide located within the following region: PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: synaptotagmin 9
• Database Link:
  NP_783860
  Entrez Gene 60510 MouseEntrez Gene 143425 Human
  UniProt ID Q86SS6
• Background: SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
• Synonyms: FLJ45896
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 86%; Dog: 79%

Reference Data

• Protein Families: Secreted Protein, Transmembrane