Rabbit Polyclonal SYTL5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SYTL5 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human SYTL5. |
Rabbit Polyclonal SYTL5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SYTL5 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human SYTL5. |
Rabbit Polyclonal Anti-SYTL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SYTL5 antibody is: synthetic peptide directed towards the middle region of Human SYTL5. Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG |
Rabbit Polyclonal Anti-SYTL5 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SYTL5 |
Rabbit Polyclonal Anti-SYTL5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SYTL5 |