SYTL5 Rabbit Polyclonal Antibody

CAT#: TA331362

Rabbit Polyclonal Anti-SYTL5 Antibody

Product Images

WB Suggested Anti-SYTL5 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SYTL5 antibody is: synthetic peptide directed towards the middle region of Human SYTL5. Synthetic peptide located within the following region: PGAEEVQSQEQTRQDAEKSDTSPVAGKKASHDGPKRKGFLLSKFRSATRG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 102 kDa
• Gene Name: synaptotagmin like 5
• Database Link:
  NP_001156806
  Entrez Gene 94122 Human
  UniProt ID Q8TDW5
• Background: The protein encoded by this gene belongs to the synaptotagmin-like (Slp) protein family, which contains a unique homology domain at the N-terminus, referred to as the Slp homology domain (SHD). The SHD functions as a binding site for Rab27A, which plays a role in protein transport. Expression of this gene is restricted to placenta and liver, suggesting that it might be involved in Rab27A-dependent membrane trafficking in specific tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Synonyms: slp5
• Note: Human: 100%; Rat: 93%; Horse: 93%; Pig: 92%; Rabbit: 86%