Antibodies

Jump to Filters
View as table Download
SCEL (Center) Rabbit Polyclonal Antibody
AP53810PU-N

USD 450.00

2 Weeks

SCEL (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 247-277 amino acids from the Central region of Human SCEL
Scel Rabbit Polyclonal Antibody
TA339796

USD 375.00

5 Days

Rabbit Polyclonal Anti-Scel Antibody

Applications WB
Reactivities Rat
Immunogen The immunogen for anti-Scel antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: DTVVYTRTYVENSKSPKDGYQENISGKYIQTVYSTSDRSVIERDMCTYCR