Rabbit Polyclonal Anti-SEC24C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SEC24C antibody is: synthetic peptide directed towards the N-terminal region of Human SEC24C. Synthetic peptide located within the following region: AVDFFGAFYMSNTTDVELAGLDGDKTVTVEFKHDDRLNEESGALLQCALL |
SEC24C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEC24C |
SEC24C Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEC24C |
SEC24C Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 915-1094 of human SEC24C (NP_004913.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China