Germany
Japan
United Kingdom
China
Rabbit polyclonal antibody to SFMBT1 (Scm-like with four mbt domains 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 13 and 225 of SFMBT1 (Uniprot ID#Q9UHJ3) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SFMBT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SFMBT1 antibody is: synthetic peptide directed towards the middle region of Human SFMBT1. Synthetic peptide located within the following region: PGNCVLVLREVLTLLINAAYKPSRVLRELQLDKDSVWHGCGEVLKAKYKG |
SFMBT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SFMBT1 |
Recombinant Anti-SFMBT1 (Clone RAB-C396)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | His Tag |
Recombinant Anti-SFMBT1 (Clone RAB-C396)
| Applications | ChIP, ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. |
Active filters
Target Symbol
- SFMBT1