Antibodies

Jump to Filters
View as table Download
SGCE Rabbit Polyclonal Antibody
TA332615

USD 275.00

3 Weeks

Rabbit anti-SGCE Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SGCE
SGCE Rabbit Polyclonal Antibody
TA339388

USD 375.00

5 Days

Rabbit Polyclonal Anti-SGCE Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCE antibody: synthetic peptide directed towards the N terminal of human SGCE. Synthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI