Antibodies

View as table Download

Rabbit anti-SGCE Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SGCE

Rabbit Polyclonal Anti-SGCE Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SGCE antibody: synthetic peptide directed towards the N terminal of human SGCE. Synthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI