SGCE Rabbit Polyclonal Antibody

CAT#: TA339388

Rabbit Polyclonal Anti-SGCE Antibody

Product Images

3Hum. Adult Placenta; Host: Rabbit; Target Name: CHAD; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  4Hum. Fetal Liver; Host: Rabbit; Target Name: FAM46C; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-SGCE Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 721_B cell lysate.SGCE is supported by BioGPS gene expression data to be expressed in 721_B

• 

  6Human 721_B; Host: Rabbit; Target Name: WT1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml.SGCE is supported by BioGPS gene expression data to be expressed in 721_B

• 

  Immunohistochemistry with pFA fixed human skeletal muscle tissue at an antibody concentration of 5.0 ug/ml using anti-SGCE antibody

• 

  Immunohistochemistry with cerebellum tissue

Show all 6 images

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGCE antibody: synthetic peptide directed towards the N terminal of human SGCE. Synthetic peptide located within the following region: TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: sarcoglycan epsilon
• Database Link:
  NP_001092871
  Entrez Gene 20392 MouseEntrez Gene 8910 Human
  UniProt ID O43556
• Background: This gene encodes the epsilon member of the sarcoglycan family. Sarcoglycans are transmembrane proteins that are components of the dystrophin-glycoprotein complex, which link the actin cytoskeleton to the extracellular matrix. Unlike other family members which are predominantly expressed in striated muscle, the epsilon sarcoglycan is more broadly expressed. Mutations in this gene are associated with myoclonus-dystonia syndrome. This gene is imprinted, with preferential expression from the paternal allele. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2010]
• Synonyms: DYT11; ESG
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane