Rabbit Polyclonal Anti-SH3BGRL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SH3BGRL antibody: synthetic peptide directed towards the middle region of human SH3BGRL. Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody,clone OTI1E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody,clone OTI2C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SH3BGRL mouse monoclonal antibody, clone OTI2H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SH3BGRL rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SH3BGRL |
SH3BGRL Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human SH3BGRL (NP_003013.1). |
| Modifications | Unmodified |
SH3BGRL mouse monoclonal antibody,clone OTI1E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3BGRL mouse monoclonal antibody,clone OTI1E5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SH3BGRL mouse monoclonal antibody,clone OTI1E5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SH3BGRL mouse monoclonal antibody,clone OTI1E5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3BGRL mouse monoclonal antibody,clone OTI2C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3BGRL mouse monoclonal antibody,clone OTI2C7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SH3BGRL mouse monoclonal antibody,clone OTI2C7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SH3BGRL mouse monoclonal antibody,clone OTI2C7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SH3BGRL mouse monoclonal antibody,clone OTI2H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SH3BGRL mouse monoclonal antibody,clone OTI2H5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
SH3BGRL mouse monoclonal antibody,clone OTI2H5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SH3BGRL mouse monoclonal antibody,clone OTI2H5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
