SH3BGRL Rabbit Polyclonal Antibody

CAT#: TA346575

Rabbit Polyclonal Anti-SH3BGRL Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human SH3 domain binding glutamic acid-rich protein like (SH3BGRL)
    • 20 ug

USD 823.00


Transient overexpression lysate of SH3 domain binding glutamic acid-rich protein like (SH3BGRL)
    • 100 ug

USD 396.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "SH3BGRL"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SH3BGRL antibody: synthetic peptide directed towards the middle region of human SH3BGRL. Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 13 kDa
Gene Name SH3 domain binding glutamate rich protein like
Background SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
Synonyms HEL-S-115; SH3BGR
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.