SH3BGRL Rabbit Polyclonal Antibody

CAT#: TA346575

Rabbit Polyclonal Anti-SH3BGRL Antibody

Product Images

WB Suggested Anti-SH3BGRL Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate.SH3BGRL is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

• 

  Rabbit Anti-SH3BGRL Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue; Observed Staining: Cytoplasmic in cell bodies of pinealocytes; Primary Antibody Concentration: 1: 100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey anti-Rabbit-Cy3; Secondary Antibody Concentration: 1: 200; Magnification: 20X; Exposure Time: 0.5–2.0 sec;

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH3BGRL antibody: synthetic peptide directed towards the middle region of human SH3BGRL. Synthetic peptide located within the following region: PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 13 kDa
• Gene Name: SH3 domain binding glutamate rich protein like
• Database Link:
  NP_003013
  Entrez Gene 6451 Human
  UniProt ID O75368
• Background: SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.
• Synonyms: HEL-S-115; SH3BGR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%