Antibodies

Jump to Filters
View as table Download
SH3BP4 (C-term) Rabbit Polyclonal Antibody
AP23478PU-N

USD 440.00

2 Weeks

SH3BP4 (C-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated
SH3BP4 Rabbit Polyclonal Antibody
TA306780

USD 430.00

5 Days

Rabbit Polyclonal SH3BP4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SH3BP4 antibody was raised against an 18 amino acid peptide from near the carboxy terminus of human SH3BP4.
SH3BP4 Rabbit Polyclonal Antibody
TA334546

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH3BP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP4 antibody: synthetic peptide directed towards the N terminal of human SH3BP4. Synthetic peptide located within the following region: FTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
SH3BP4 Rabbit Polyclonal Antibody
TA334547

USD 375.00

5 Days

Rabbit Polyclonal Anti-SH3BP4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP4 antibody is: synthetic peptide directed towards the N-terminal region of Human SH3BP4. Synthetic peptide located within the following region: PSSYVQPLNYRNSTLSDSGMIDNLPDSPDEVAKELELLGGWTDDKKVPGR
SH3BP4 Rabbit Polyclonal Antibody
TA381459

USD 220.00

3 Weeks

SH3BP4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 784-963 of human SH3BP4 (NP_055336.1).
Modifications Unmodified