Germany
Japan
United Kingdom
China
Antibodies
View as table Download
NKCC1 (SLC12A2) mouse monoclonal antibody, clone 5H7, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SLC12A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC12A2 Antibody: synthetic peptide directed towards the C terminal of human SLC12A2. Synthetic peptide located within the following region: IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI |
NKCC1 (SLC12A2) (769-783) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Chicken, Equine, Human, Porcine |
| Immunogen | Synthetic peptide from an internal region of human SLC12A2 / NKCC1 (NP_001037.1) |
Rabbit Polyclonal Anti-SLC12A2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 19 amino acid peptide from N-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (89%); Monkey, Marmoset, Ferret, Dog, Panda (84%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 18 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Bovine, Pig (89%); Ferret, Dog, Bat, Panda (83%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Bovine, Dog, Bat, Hamster, Panda, Horse, Pig (100%); Elephant, Lizard (94%); Opossum, Chicken (88%); Turkey (82%). |
Rabbit Polyclonal Anti-SLC12A2 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SLC12A2 / NKCC1 antibody was raised against synthetic 15 amino acid peptide from internal region of human SLC12A2 / NKCC1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Ferret, Elephant, Panda, Bovine, Dog, Horse, Pig, Opossum, Guinea pig (100%); Bat (93%). |
SLC12A2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-280 of human SLC12A2 (NP_001037.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC12A2