Rabbit Polyclonal Anti-SLC16A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC16A1 Antibody: synthetic peptide directed towards the middle region of human SLC16A1. Synthetic peptide located within the following region: EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL |
Rabbit Polyclonal Anti-SLC16A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC16A1 Antibody: synthetic peptide directed towards the middle region of human SLC16A1. Synthetic peptide located within the following region: KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTIN |
Anti-SLC16A1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 484-500 amino acids of Human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
Anti-SLC16A1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 486-500 amino acids of Human solute carrier family 16, member 1 (monocarboxylic acid transporter 1) |
Monocarboxylic Acid Transporter 1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Monocarboxylic acid transporter 1 |
Germany
Japan
United Kingdom
China
