Monocarboxylic acid transporter 1 (SLC16A1) Rabbit Polyclonal Antibody

CAT#: TA334045

Rabbit Polyclonal Anti-SLC16A1 Antibody

Product Images

WB Suggested Anti-SLC16A1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: HT1080 cell lysate;SLC16A1 is strongly supported by BioGPS gene expression data to be expressed in Human HT1080 cells

• 

  Rabbit Anti-SLC16A1 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue; Observed Staining: Membrane and cytoplasmic; Primary Antibody Concentration: 1:100; Other Working Concentrations: 1/600; Secondary Antibody: Donkey a

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC16A1 Antibody: synthetic peptide directed towards the middle region of human SLC16A1. Synthetic peptide located within the following region: EKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGFL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: solute carrier family 16 member 1
• Database Link:
  NP_003042
  Entrez Gene 6566 Human
  UniProt ID P53985
• Background: The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate transporter defect. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]
• Synonyms: HHF7; MCT; MCT1; MCT1D
• Note: Immunogen sequence homology: Human: 100%

Reference Data

• Protein Families: Transmembrane