Rabbit Polyclonal Anti-SLC16A7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC16A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC16A7. Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA |
Goat Polyclonal Antibody against SLC16A7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SNAQSVTSERETNI, from the C Terminus of the protein sequence according to NP_004722. |
Anti-SLC16A7 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide peptide corresponding to a region derived from 465-478 amino acids of human solute carrier family 16, member 7 (monocarboxylic acid transporter 2) |
SLC16A7 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SLC16A7 |
SLC16A7 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human SLC16A7 (NP_001257551.1). |
| Modifications | Unmodified |
SLC16A7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human SLC16A7 (NP_001257551.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
