MCT2 (SLC16A7) Rabbit Polyclonal Antibody

CAT#: TA334064

Rabbit Polyclonal Anti-SLC16A7 Antibody

Product Images

Host: Rabbit; Target Name: SLC16A7; Sample Tissue: Fetal Heart lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC16A7 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC16A7. Synthetic peptide located within the following region: LAGKLVDLTGEYKYMYMSCGAIVVAASVWLLIGNAINYRLLAKERKEENA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: solute carrier family 16 member 7
• Database Link:
  NP_001257551
  Entrez Gene 9194 Human
  UniProt ID O60669
• Background: The function of this protein remains unknown.
• Synonyms: MCT2
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Pig: 79%; Rat: 79%; Zebrafish: 79%; Guinea pig: 75%

Reference Data

• Protein Families: Transmembrane