Antibodies

Jump to Filters
View as table Download
SLC17A4 Rabbit Polyclonal Antibody
TA333941

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC17A4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC17A4 Antibody: synthetic peptide directed towards the middle region of human SLC17A4. Synthetic peptide located within the following region: YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL