Rabbit Polyclonal Anti-Excitatory Amino Acid Transporter 4 (extracellular)
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)TRTIVRTDNGSE, corresponding to amino acid residues 205- 216 of rat EAAT4. 2nd extracellular loop. |
Rabbit Polyclonal Anti-SLC1A6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC1A6 Antibody is: synthetic peptide directed towards the C-terminal region of Human SLC1A6. Synthetic peptide located within the following region: QFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGT |
Anti-SLC1A6 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 205-220 amino acids of Human Solute carrier family 1 member 6 |
SLC1A6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 155-265 of human SLC1A6 (NP_001259016.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
