Antibodies

Jump to Filters
View as table Download
SLC22A25 Rabbit Polyclonal Antibody
TA334881

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SLC22A25 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC22A25 antibody is: synthetic peptide directed towards the middle region of Human SLC22A25. Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL