SLC22A25 Rabbit Polyclonal Antibody

CAT#: TA334881

Rabbit Polyclonal Anti-SLC22A25 Antibody

Product Images

Host: Rabbit; Target Name: SLC22A25; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC22A25 antibody is: synthetic peptide directed towards the middle region of Human SLC22A25. Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: solute carrier family 22 member 25
• Database Link:
  NP_955384
  Entrez Gene 387601 Human
  UniProt ID Q6T423
• Background: The function of this protein remains unknown.
• Synonyms: HIMTP; UST6
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rabbit: 93%; Dog: 92%; Horse: 92%; Bovine: 85%; Rat: 83%; Mouse: 83%

Reference Data

• Protein Families: Transmembrane