Germany
Japan
United Kingdom
China
SLC23A2 (N-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human SLC23A2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLC23A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC23A2 Antibody: synthetic peptide directed towards the middle region of human SLC23A2. Synthetic peptide located within the following region: VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK |
SLC23A2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC23A2 (NP_976072.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SLC23A2