SLC23A2 Rabbit Polyclonal Antibody

CAT#: TA333947

Rabbit Polyclonal Anti-SLC23A2 Antibody

Product Images

WB Suggested Anti-SLC23A2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: SH-SYSY cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC23A2 Antibody: synthetic peptide directed towards the middle region of human SLC23A2. Synthetic peptide located within the following region: VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: solute carrier family 23 member 2
• Database Link:
  NP_005107
  Entrez Gene 9962 Human
  UniProt ID Q9UGH3
• Background: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.
• Synonyms: hSVCT2; NBTL1; SLC23A1; SVCT2; YSPL2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane