Rabbit Polyclonal Anti-SLC25A24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC25A24 Antibody: synthetic peptide directed towards the middle region of human SLC25A24. Synthetic peptide located within the following region: FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLA |
Rabbit Polyclonal Anti-SLC25A24 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC25A24 antibody: synthetic peptide directed towards the N terminal of human SLC25A24. Synthetic peptide located within the following region: MDSLYGDLFWYLDYNKDGTLDIFELQEGLEDVGAIQSLEEAKKIFTTGDV |
SLC25A24 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCMC1 |
SLC25A24 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human SLC25A24 (NP_037518.3). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China