Antibodies

View as table Download

Rabbit polyclonal SLC25A31 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SLC25A31 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 139-167 amino acids from the Central region of human SLC25A31.

Rabbit polyclonal anti-SLC25A31 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC25A31.

Rabbit Polyclonal Anti-Slc25a31 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Slc25a31 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV

Rabbit Polyclonal Anti-SLC25A31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A31 Antibody: synthetic peptide directed towards the N terminal of human SLC25A31. Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP

SLC25A31 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human SLC25A31 (NP_112581.1).
Modifications Unmodified