Slc25a31 Rabbit Polyclonal Antibody

CAT#: TA335356

Rabbit Polyclonal Anti-Slc25a31 Antibody

Product Images

WB Suggested Anti-Slc25a31 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Slc25a31 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARTRLGVDIGKGPEQRQFTGLGDCIMKIAKSDGLIGLYQGFGVSVQGIIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 31
• Database Link:
  NP_848473
  Entrez Gene 73333 Mouse
  UniProt ID Q3V132
• Background: Slc25a31 catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. It may serve to mediate energy generating and energy consuming processes in the distal flagellum, possibly as a nucleotide shuttle between flagellar glycolysis, protein phosphorylation and mechanisms of motility.
• Synonyms: AAC4; ANT4; DKFZp434N1235; SFEC; SFEC35kDa
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%