Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC25A46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the N terminal of human SLC25A46. Synthetic peptide located within the following region: RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP

Rabbit Polyclonal Anti-SLC25A46 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the C terminal of human SLC25A46. Synthetic peptide located within the following region: LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH