SLC25A46 Rabbit Polyclonal Antibody

CAT#: TA333536

Rabbit Polyclonal Anti-SLC25A46 Antibody

Product Images

WB Suggested Anti-SLC25A46 Antibody Titration: 0.2-1 ug/ml; Positive Control: MCF7 cell lysate;SLC25A46 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC25A46 Antibody: synthetic peptide directed towards the C terminal of human SLC25A46. Synthetic peptide located within the following region: LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: solute carrier family 25 member 46
• Database Link:
  NP_620128
  Entrez Gene 91137 Human
  UniProt ID Q96AG3
• Background: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins (Haitina et al., 2006 [PubMed 16949250]). [supplied by OMIM]
• Synonyms: HMSN6B
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Dog: 86%; Rabbit: 86%