Antibodies

View as table Download

Rabbit Polyclonal Anti-SLC2A13 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC2A13 Antibody: synthetic peptide directed towards the middle region of human SLC2A13. Synthetic peptide located within the following region: GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNEC

SLC2A13 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3).
Modifications Unmodified