SLC2A13 Rabbit Polyclonal Antibody

CAT#: TA333571

Rabbit Polyclonal Anti-SLC2A13 Antibody

Product Images

WB Suggested Anti-SLC2A13 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC2A13 Antibody: synthetic peptide directed towards the middle region of human SLC2A13. Synthetic peptide located within the following region: GSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: solute carrier family 2 member 13
• Database Link:
  NP_443117
  Entrez Gene 114134 Human
  UniProt ID Q96QE2
• Background: SLC2A13 is an H (+)-myo-inositol cotransporter. It can also transport related stereoisomers.
• Synonyms: HMIT
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Rat: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane