Antibodies

Jump to Filters
View as table Download
SLC35G2 Rabbit Polyclonal Antibody
TA334393

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC35G2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC35G2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35G2. Synthetic peptide located within the following region: LQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSP
SLC35G2 Rabbit Polyclonal Antibody
TA361845

USD 360.00

5 Days

SLC35G2 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM22