SLC35G2 Rabbit Polyclonal Antibody

CAT#: TA334393

Rabbit Polyclonal Anti-SLC35G2 Antibody

Product Images

WB Suggested Anti-SLC35G2 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC35G2 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35G2. Synthetic peptide located within the following region: LQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRKQDYQEILDSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: solute carrier family 35 member G2
• Database Link:
  NP_079522
  Entrez Gene 80723 Human
  UniProt ID Q8TBE7
• Background: The function of this protein remains unknown.
• Synonyms: TMEM22
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane