Antibodies

Jump to Filters
View as table Download
SLC39A9 Rabbit Polyclonal Antibody
TA319958

USD 430.00

5 Days

Rabbit Polyclonal ZIP9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZIP9 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human ZIP9.
SLC39A9 Rabbit Polyclonal Antibody
TA315582

USD 345.00

4 Weeks

Rabbit polyclonal anti-SLC39A9 antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC39A9.
SLC39A9 Rabbit Polyclonal Antibody
TA333753

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC39A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC39A9 Antibody: synthetic peptide directed towards the middle region of human SLC39A9. Synthetic peptide located within the following region: YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA
SLC39A9 Rabbit Polyclonal Antibody
TA351698

USD 345.00

In Stock

Rabbit Polyclonal Anti-SLC39A9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human SLC39A9