SLC39A9 Rabbit Polyclonal Antibody

CAT#: TA333753

Rabbit Polyclonal Anti-SLC39A9 Antibody

Product Images

WB Suggested Anti-SLC39A9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: U937 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC39A9 Antibody: synthetic peptide directed towards the middle region of human SLC39A9. Synthetic peptide located within the following region: YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 32 kDa
• Gene Name: solute carrier family 39 member 9
• Database Link:
  NP_060845
  Entrez Gene 55334 Human
  UniProt ID Q9NUM3
• Background: SLC39A9 may act as a zinc-influx transporter.
• Synonyms: ZIP-9; ZIP9
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Rat: 83%; Rabbit: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane