Rabbit Polyclonal Anti-SLC4A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC4A5 Antibody: synthetic peptide directed towards the middle region of human SLC4A5. Synthetic peptide located within the following region: SIAHIDSLKMETETSAPGEQPQFLGVREQRVTGIIVFILTGISVFLAPIL |
Rabbit Polyclonal Anti-SLC4A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC4A5 Antibody: synthetic peptide directed towards the N terminal of human SLC4A5. Synthetic peptide located within the following region: RWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDSGSLPQIIDDVIEKQIED |
SLC4A5 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1042-1121 of human SLC4A5 (NP_597812.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China