SLC4A5 Rabbit Polyclonal Antibody

CAT#: TA333725

Rabbit Polyclonal Anti-SLC4A5 Antibody

Product Images

WB Suggested Anti-SLC4A5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC4A5 Antibody: synthetic peptide directed towards the N terminal of human SLC4A5. Synthetic peptide located within the following region: RWSKPHVSTLSLHSLFELRTCLQTGTVLLDLDSGSLPQIIDDVIEKQIED
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 126 kDa
• Gene Name: solute carrier family 4 member 5
• Database Link:
  NP_067019
  Entrez Gene 57835 Human
  UniProt ID Q9BY07
• Background: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.
• Synonyms: NBC4; NBCe2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane