Antibodies

Jump to Filters
View as table Download
SLC6A18 Rabbit Polyclonal Antibody
TA334626

USD 310.00

5 Days

Rabbit Polyclonal Anti-SLC6A18 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC6A18 antibody: synthetic peptide directed towards the middle region of human SLC6A18. Synthetic peptide located within the following region: MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP
SLC6A18 Rabbit Polyclonal Antibody
TA381692

USD 220.00

3 Weeks

SLC6A18 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-400 of human SLC6A18 (NP_872438.2).
Modifications Unmodified