Antibodies

Jump to Filters
View as table Download
SLC7A4 Rabbit Polyclonal Antibody
TA314546

USD 345.00

4 Weeks

Rabbit polyclonal anti-SLC7A4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SLC7A4.
SLC7A4 Rabbit Polyclonal Antibody
TA333980

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC7A4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC7A4 Antibody: synthetic peptide directed towards the middle region of human SLC7A4. Synthetic peptide located within the following region: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN