SLC7A4 Rabbit Polyclonal Antibody

CAT#: TA333980

Rabbit Polyclonal Anti-SLC7A4 Antibody

Product Images

WB Suggested Anti-SLC7A4 Antibody Titration: 0.125 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC7A4 Antibody: synthetic peptide directed towards the middle region of human SLC7A4. Synthetic peptide located within the following region: GAYILVSTVLTLMVPWHSLDPDSALADAFYQRGYRWAGFIVAAGSICAMN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: solute carrier family 7 member 4
• Database Link:
  NP_004164
  Entrez Gene 6545 Human
  UniProt ID O43246
• Background: SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
• Synonyms: CAT-4; CAT4; HCAT3; VH
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%; Dog: 85%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome, Transmembrane