Germany
Japan
United Kingdom
China
SLFNL1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 65-95 amino acids from the N-terminal region of Human SLFNL1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SLFNL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLFNL1 antibody: synthetic peptide directed towards the middle region of human SLFNL1. Synthetic peptide located within the following region: TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL |
Carrier-free (BSA/glycerol-free) SLFNL1 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLFNL1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SLFNL1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SLFNL1 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLFNL1 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SLFNL1 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLFNL1 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
SLFNL1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLFNL1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SLFNL1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLFNL1 mouse monoclonal antibody, clone OTI5C3 (formerly 5C3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SLFNL1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SLFNL1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
SLFNL1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
SLFNL1 mouse monoclonal antibody, clone OTI1G3 (formerly 1G3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SLFNL1