SLFNL1 Rabbit Polyclonal Antibody

CAT#: TA340374

Rabbit Polyclonal Anti-SLFNL1 Antibody

Product Images

WB Suggested Anti-SLFNL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLFNL1 antibody: synthetic peptide directed towards the middle region of human SLFNL1. Synthetic peptide located within the following region: TVHTPKAQSQPQLYQTDQGEVFLRRDGSIQGPLSASAIQEWCRQRWLVEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: schlafen like 1
• Database Link:
  NP_659427
  Entrez Gene 200172 Human
  UniProt ID Q499Z3
• Background: SLFNL1 belongs to the Schlafen family. The function of the SLFNL1 protein remains unknown.
• Synonyms: FLJ23878; MGC43873
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Guinea pig: 86%