Antibodies

Jump to Filters
View as table Download
SMAP2 (Center) Rabbit Polyclonal Antibody
AP53941PU-N

USD 450.00

2 Weeks

SMAP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 110-140 amino acids from the Central region of Human SMAP2.
SMAP2 Rabbit Polyclonal Antibody
TA331295

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE
SMAP2 Rabbit Polyclonal Antibody
TA331296

USD 375.00

5 Days

Rabbit Polyclonal Anti-SMAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the C-terminal region of Human SMAP2. Synthetic peptide located within the following region: KVVGSMPTAGSAGSVPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQT
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
CF811178

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
CF811191

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
TA811178

USD 379.00

In Stock

SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI6E11]
TA811178S

USD 159.00

2 Days

SMAP2 mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
TA811191

USD 379.00

In Stock

SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SMAP2 Mouse Monoclonal Antibody [Clone ID: OTI9B6]
TA811191S

USD 159.00

2 Days

SMAP2 mouse monoclonal antibody,clone OTI9B6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated