SMAP2 Rabbit Polyclonal Antibody

CAT#: TA331295

Rabbit Polyclonal Anti-SMAP2 Antibody

Product Images

Host: Rabbit; Target Name: SMAP2; Sample Tissue: U937 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SMAP2 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAP2. Synthetic peptide located within the following region: LPETFRRPQIDPAVEGFIRDKYEKKKYMDRSLDINAFRKEKDDKWKRGSE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: small ArfGAP2
• Database Link:
  NP_073570
  Entrez Gene 64744 Human
  UniProt ID Q8WU79
• Background: SMAP2 is a GTPase activating protein that acts on ARF1. It can also activate ARF6 and may play a role in clathrin-dependent retrograde transport from early endosomes to the trans-Golgi network.
• Synonyms: SMAP1L
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 92%

Reference Data

• Protein Pathways: Endocytosis