Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SMARCB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCB1 antibody: synthetic peptide directed towards the N terminal of human SMARCB1. Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT |
Rabbit Polyclonal Anti-SMARCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMARCB1 antibody: synthetic peptide directed towards the middle region of human SMARCB1. Synthetic peptide located within the following region: ILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHV |
Rabbit Polyclonal Anti-SMARCB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCB1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SMARCB1. Synthetic peptide located within the following region: MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWR |
SMARCB1 Rabbit monoclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SMARCB1